| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JQ276647.1 | complete | 101 | 1-306(+) |
Amino Acid sequence : | |||
| MMFEHVLFLSVYLFSIGIYGLITSRNMVRALMCLELILNSVNMNLVTFSDIFDSRQLKGNIFSIFVIAIAAAEAAIGLAIVSSIHRNRKSTRINQSNLLNN* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,310.245 | ||
| Theoretical pI: | 9.618 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 29.650 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.668 | ||
Secondary Structure Fraction | |||
| Helix | 0.416 | ||
| turn | 0.248 | ||
| sheet | 0.287 | ||