Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JQ276742.1 | complete | 204 | 1-615(+) |
Amino Acid sequence : | |||
MPIGVPKVPFRSPGEEDAVWVDVYNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDNTKDIYLFINSPGGWVIPGIAIYDTMQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPH ARVMIHQPASSFYEAQAGEFILEAEELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHGIVDLVAVENQNTRDLI* | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 22,905.057 | ||
Theoretical pI: | 4.627 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
Instability index: | 39.930 | ||
aromaticity | 0.093 | ||
GRAVY | 0.090 | ||
Secondary Structure Fraction | |||
Helix | 0.363 | ||
turn | 0.211 | ||
sheet | 0.284 |