Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JQ276936.1 | complete | 180 | 1-543(+) |
Amino Acid sequence : | |||
MFPMVTGFLNYGQQTIRAARYIGQGFIITLSYTNRLPVTIQYPYEKSIVSERFRGRIHFEFDKCIACEVCVRVCPIDLPVVDWRFEKDIKKKQLLNYSIDFGVCIFCGNCVEYCPTNCLS MTEEYELSTYDRHELNYNQITLGRLPMSVVGDYSIQTVMNSTQIKMNKDKPLDSRTITNY* | |||
Physicochemical properties | |||
Number of amino acids: | 180 | ||
Molecular weight: | 20,987.045 | ||
Theoretical pI: | 7.477 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23880 | ||
Instability index: | 24.527 | ||
aromaticity | 0.122 | ||
GRAVY | -0.188 | ||
Secondary Structure Fraction | |||
Helix | 0.350 | ||
turn | 0.206 | ||
sheet | 0.172 |