Acc_NO	ORF type	length	start-end position (strand +/-)
>JQ276936.1	complete	180	1-543(+)
Amino Acid sequence :
MFPMVTGFLNYGQQTIRAARYIGQGFIITLSYTNRLPVTIQYPYEKSIVSERFRGRIHFEFDKCIACEVCVRVCPIDLPVVDWRFEKDIKKKQLLNYSIDFGVCIFCGNCVEYCPTNCLS MTEEYELSTYDRHELNYNQITLGRLPMSVVGDYSIQTVMNSTQIKMNKDKPLDSRTITNY*
Physicochemical properties
Number of amino acids:		180
Molecular weight:		20,987.045
Theoretical pI:		7.477
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23380 23880
Instability index:		24.527
aromaticity		0.122
GRAVY		-0.188
Secondary Structure Fraction
Helix		0.350
turn		0.206
sheet		0.172