Acc_NO	ORF type	length	start-end position (strand +/-)
>JQ276985.1	complete	158	1-477(+)
Amino Acid sequence :
MQVRLSDWLVKHELIHRSLGFDCRGVETLQIKTEDWDSIAVISYVYGYNYLRSQCAYDVAPGGFLASVYHLTKIRYGIDKPKEVCIKVFAPRSNPRIPSVFWIWKSADFQERESYDMLGI SYDNHPRLKRILMPESWIGWPLRKDYITPNFYEIQDAH*
Physicochemical properties
Number of amino acids:		158
Molecular weight:		18,680.202
Theoretical pI:		7.721
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		49390 49515
Instability index:		40.888
aromaticity		0.146
GRAVY		-0.349
Secondary Structure Fraction
Helix		0.373
turn		0.209
sheet		0.190