Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JQ277034.1 | complete | 284 | 1-855(+) |
Amino Acid sequence : | |||
MGNEFGCIGRIRIYRSFHFRAYPNCWFSLCMAKRSIGMVLVKYSDNQKDKKEGKDSIETVMNLIDFPLLDQTTPNSVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFASLIGSRFDFDR YGLVPRSSPRQADLILTAGTVTMKMAPSLVRLYEQMPEPKYVIAMGACTITGGMFSTDSYSTVRGVDKLIPVDVYLPGCPPKPEAVIDAITKLRKKISREIFEDRTLSQQENRCFTTNHK FSVRRSTHTGNYDQGLLYQSPSTSEIPFKTFFKSKSKVQYPHTN* | |||
Physicochemical properties | |||
Number of amino acids: | 284 | ||
Molecular weight: | 32,241.701 | ||
Theoretical pI: | 9.198 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34880 | ||
Instability index: | 48.139 | ||
aromaticity | 0.109 | ||
GRAVY | -0.313 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.261 | ||
sheet | 0.183 |