Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JQ283851.1 | 5prime_partial | 121 | 434-69(-) |
Amino Acid sequence : | |||
APIRFPPDNFKHSLTLFSKSFSSFPRGTCSLSVSRRYLALDGIYRPIRAAFPNNPTRRQRLVVRQGPGRTGLSPSRAPLSRGLGPGPSLRTLLQTTIRAARPPDSQAGLFPVRSPLLGES L* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 13,222.105 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 58.840 | ||
aromaticity | 0.074 | ||
GRAVY | -0.355 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.364 | ||
sheet | 0.207 |