Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JQ673531.1 | internal | 176 | 2-529(+) |
Amino Acid sequence : | |||
YRLTYYTPEYKTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVLGEDNQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLR IPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRG | |||
Physicochemical properties | |||
Number of amino acids: | 176 | ||
Molecular weight: | 19,610.076 | ||
Theoretical pI: | 8.382 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
Instability index: | 29.436 | ||
aromaticity | 0.119 | ||
GRAVY | -0.328 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.227 | ||
sheet | 0.250 |