Acc_NO	ORF type	length	start-end position (strand +/-)
>JQ815388.1	5prime_partial	188	1-567(+)
Amino Acid sequence :
ESPLPKPVLDTNGNELNPNLSYRIISTFWGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPSGTPVRFIPLSGANICEDHLLNIQFNIPTVKLCVSYTIWKVGNINAYLRTMLLETGGTI GQADSSYFKIVKSSKIGYNLFYCPSTPFICPLCPDDLFCAKVGVVIQNGKRRLALVNENPLEVLFQEV*
Physicochemical properties
Number of amino acids:		188
Molecular weight:		20,579.418
Theoretical pI:		5.829
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22920 23295
Instability index:		31.835
aromaticity		0.101
GRAVY		0.028
Secondary Structure Fraction
Helix		0.356
turn		0.324
sheet		0.186