Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JQ815389.1 | 5prime_partial | 189 | 1-570(+) |
Amino Acid sequence : | |||
ESPVPKPVLDTNGKKLNPNSSYRIISTFWGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPSGTPVRFIPLSGANIFEDQLLNIQFNIPTVKLCVSYTIWKVGNINAHLRTMLLETGGAI GQADSSYFKIVKSSKFGYNLLYCPLTRHFLCPFCRDDNFCAKVGVVIQNGKRRLALVNENPLEVLFQEV* | |||
Physicochemical properties | |||
Number of amino acids: | 189 | ||
Molecular weight: | 20,847.722 | ||
Theoretical pI: | 8.743 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21805 | ||
Instability index: | 29.620 | ||
aromaticity | 0.106 | ||
GRAVY | -0.070 | ||
Secondary Structure Fraction | |||
Helix | 0.349 | ||
turn | 0.312 | ||
sheet | 0.180 |