Acc_NO	ORF type	length	start-end position (strand +/-)
>JQ815389.1	5prime_partial	189	1-570(+)
Amino Acid sequence :
ESPVPKPVLDTNGKKLNPNSSYRIISTFWGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPSGTPVRFIPLSGANIFEDQLLNIQFNIPTVKLCVSYTIWKVGNINAHLRTMLLETGGAI GQADSSYFKIVKSSKFGYNLLYCPLTRHFLCPFCRDDNFCAKVGVVIQNGKRRLALVNENPLEVLFQEV*
Physicochemical properties
Number of amino acids:		189
Molecular weight:		20,847.722
Theoretical pI:		8.743
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		21430 21805
Instability index:		29.620
aromaticity		0.106
GRAVY		-0.070
Secondary Structure Fraction
Helix		0.349
turn		0.312
sheet		0.180