Acc_NO	ORF type	length	start-end position (strand +/-)
>JQ815390.1	5prime_partial	189	2-571(+)
Amino Acid sequence :
NLLYLSRYLIQMVKKLNPNSSYRIISTFWGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPSGTPVRFIPLSGANIFEDQLLNIQFNIPTVKLCVSYTIWKVGNINAHLRTMLLETGGTI GQADSSYFKIVKSSKFGYNLLYCPLTRHFLCPFCRDDNFCAKVGVVIQNGKRRLALVNENPLDVLFQEV*
Physicochemical properties
Number of amino acids:		189
Molecular weight:		21,137.204
Theoretical pI:		9.041
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		24410 24785
Instability index:		26.920
aromaticity		0.116
GRAVY		0.021
Secondary Structure Fraction
Helix		0.376
turn		0.291
sheet		0.185