Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JQ934030.1 | internal | 222 | 2-667(+) |
Amino Acid sequence : | |||
SVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAE | |||
Physicochemical properties | |||
Number of amino acids: | 222 | ||
Molecular weight: | 24,951.093 | ||
Theoretical pI: | 6.724 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37360 37610 | ||
Instability index: | 30.057 | ||
aromaticity | 0.126 | ||
GRAVY | -0.367 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.212 | ||
sheet | 0.248 |