| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JQ971976.1 | internal | 212 | 637-2(-) |
Amino Acid sequence : | |||
| IAVYVDDMNLIGTTSDISDTVDILKKEFEMKDLGKTRFCLGLQIEHRKDGILIHQESYTQKVLRRFSHSDAKPSATPMIVRSLDVTKDPFRPRCDDEEILSPECSYLGAIGALLYLAQCT RPDISFAVNCLARHSSAPTRRHWNDIKDIFRYLKGTSDLGLFYPYALSSETNSLGARSNATLIGYADAGYLSDPHKGRSQSGYVFTIGNTAI | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 23,647.531 | ||
| Theoretical pI: | 6.649 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20650 | ||
| Instability index: | 45.893 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.289 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.231 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JQ971976.1 | internal | 212 | 637-2(-) |
Amino Acid sequence : | |||
| IAVYVDDMNLIGTTSDISDTVDILKKEFEMKDLGKTRFCLGLQIEHRKDGILIHQESYTQKVLRRFSHSDAKPSATPMIVRSLDVTKDPFRPRCDDEEILSPECSYLGAIGALLYLAQCT RPDISFAVNCLARHSSAPTRRHWNDIKDIFRYLKGTSDLGLFYPYALSSETNSLGARSNATLIGYADAGYLSDPHKGRSQSGYVFTIGNTAI | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 23,647.531 | ||
| Theoretical pI: | 6.649 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20650 | ||
| Instability index: | 45.893 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.289 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.231 | ||
| sheet | 0.222 | ||