Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JX125078.1 | 5prime_partial | 166 | 2-502(+) |
Amino Acid sequence : | |||
AKSLYVLKKYNKLTYYTPDYVPKDTDTLAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRERGICEFLLLILKTFQGPPHGIQVERDKIKQVWASPIGMYY* | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 18,624.045 | ||
Theoretical pI: | 5.476 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34505 | ||
Instability index: | 24.713 | ||
aromaticity | 0.133 | ||
GRAVY | -0.181 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.211 | ||
sheet | 0.241 |