| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JX465689.1 | internal | 214 | 1-642(+) |
Amino Acid sequence : | |||
| KEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLED LRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKSQAE | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 24,221.227 | ||
| Theoretical pI: | 6.244 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37360 37610 | ||
| Instability index: | 32.543 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.425 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.210 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JX465689.1 | internal | 214 | 1-642(+) |
Amino Acid sequence : | |||
| KEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLED LRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKSQAE | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 24,221.227 | ||
| Theoretical pI: | 6.244 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37360 37610 | ||
| Instability index: | 32.543 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.425 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.210 | ||
| sheet | 0.243 | ||