| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JX465691.1 | internal | 212 | 1-636(+) |
Amino Acid sequence : | |||
| EYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDL RIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKSQA | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 23,963.940 | ||
| Theoretical pI: | 6.230 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37360 37610 | ||
| Instability index: | 32.756 | ||
| aromaticity | 0.127 | ||
| GRAVY | -0.394 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.212 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JX465691.1 | internal | 212 | 1-636(+) |
Amino Acid sequence : | |||
| EYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDL RIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKSQA | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 23,963.940 | ||
| Theoretical pI: | 6.230 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37360 37610 | ||
| Instability index: | 32.756 | ||
| aromaticity | 0.127 | ||
| GRAVY | -0.394 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.212 | ||
| sheet | 0.241 | ||