Acc_NO	ORF type	length	start-end position (strand +/-)
>JX511990.1	internal	202	1-606(+)
Amino Acid sequence :
VGFKAGVKEYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKAL RALRLEDLRIPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFM
Physicochemical properties
Number of amino acids:		202
Molecular weight:		22,557.397
Theoretical pI:		8.340
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		30370 30495
Instability index:		22.469
aromaticity		0.119
GRAVY		-0.366
Secondary Structure Fraction
Helix		0.317
turn		0.218
sheet		0.233