Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JX555963.1 | complete | 121 | 717-1082(+) |
Amino Acid sequence : | |||
MTCRGWGCPIISKMSSKKSCPLYISTITITRTLFQKKKGISTPHLLHLGSSENMVFKSHKVSQYQYNSILSIPQIYSPLLNWEPAYMQRYSTVSRTKRVSSKRALATTPEDCCNCMKLPF C* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 11,858.897 | ||
Theoretical pI: | 9.565 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.543 | ||
aromaticity | 0.121 | ||
GRAVY | -0.053 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.172 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JX555963.1 | 5prime_partial | 116 | 1-351(+) |
Amino Acid sequence : | |||
ERERKERLIMALKVFSVATQMAIPSKLTTCLQPSHLKSSPKLFSSTNSSGRSRLRVYCSSSQLTTERRSGNYNPSRWDVEFIQSLHSDYKVCKTRSFRQGRSQENVYGRGEISYMG* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 11,858.897 | ||
Theoretical pI: | 9.565 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.543 | ||
aromaticity | 0.121 | ||
GRAVY | -0.053 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.172 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JX555963.1 | complete | 109 | 1913-2242(+) |
Amino Acid sequence : | |||
MERILFFFLLKKHKIQSYHQNLSFNLIYRKMKMFNQSYKKNVIRWDINSIDQLPDYMQLCFLALNNFVDDTSYDVMKEKGVNVIPYLRQSVITKLINNHHHFYILANNN* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 11,858.897 | ||
Theoretical pI: | 9.565 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.543 | ||
aromaticity | 0.121 | ||
GRAVY | -0.053 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.172 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JX555963.1 | complete | 101 | 2612-2917(+) |
Amino Acid sequence : | |||
MYVQEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWLIAEVWKKMNAERVSKDSPFGKDFIGCAVDLGRMAQLMYHNGDGHGTQHPIIHQQMTRTLFEPFA* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,858.897 | ||
Theoretical pI: | 9.565 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.543 | ||
aromaticity | 0.121 | ||
GRAVY | -0.053 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.172 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JX555963.1 | complete | 101 | 1203-898(-) |
Amino Acid sequence : | |||
MSKEYAILVKRSPSPPPSFTLSSKNLVANSLADSSVVSPSVNRKEASYSCNNPLVSSLRLSLNSPSSFLKLSNTSAYMPVPNLVKENKFVEWKVWNYIDIG* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,858.897 | ||
Theoretical pI: | 9.565 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.543 | ||
aromaticity | 0.121 | ||
GRAVY | -0.053 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.172 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JX555963.1 | complete | 99 | 877-578(-) |
Amino Acid sequence : | |||
MFSEEPKCKRCGVEIPFFFWKRVLVIVMVEIYRGQDFFELILEMIGQPHPLQVIDQLKLSNLIRFFLQFHLHQSDQLRSPNRVFVLLHTARGGRRKNCQ* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,858.897 | ||
Theoretical pI: | 9.565 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.543 | ||
aromaticity | 0.121 | ||
GRAVY | -0.053 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.172 | ||
sheet | 0.222 |