Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JX555972.1 | complete | 121 | 720-1085(+) |
Amino Acid sequence : | |||
MTCRGWGCPIISKMSSKKSCPLYISTITITRTLFQKKKGISTPHLLHLGSSENMVFKSHKVSQYQYNSILSIPQIYSPLLNWEPAYMQRYSTVSRTKRVSSKRALATTPEDCCNCMKLPF C* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 11,858.897 | ||
Theoretical pI: | 9.565 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.543 | ||
aromaticity | 0.121 | ||
GRAVY | -0.053 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.172 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JX555972.1 | complete | 121 | 1550-1915(+) |
Amino Acid sequence : | |||
MIDGPNFFFFLIYIIDLSCIYWNRWWRNTGFVEKLPFARDRLVECYFWNTGIIEPRQHASARIMMGKVNALITVIDDIYDVYGTLEELEQFTDLIRRLAISPSVPFIKRLFNFFFFFRFH L* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 11,858.897 | ||
Theoretical pI: | 9.565 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.543 | ||
aromaticity | 0.121 | ||
GRAVY | -0.053 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.172 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JX555972.1 | 5prime_partial | 117 | 1-354(+) |
Amino Acid sequence : | |||
ERERKERLIMALKVFSVATQMAIPSKLTTCLQPSHLKSSPKLFSSTNKCSGRSRLRVYCSSSQLTTERRSGNYNPSRWDVEFIQSLHSDYKVCKTRSFRQGQSQENVYGRGEISYMG* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 11,858.897 | ||
Theoretical pI: | 9.565 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.543 | ||
aromaticity | 0.121 | ||
GRAVY | -0.053 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.172 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JX555972.1 | complete | 101 | 2628-2933(+) |
Amino Acid sequence : | |||
MYVQEEVSRGDVPKSLQCYMSVYNASEAEARKHVKWLIAEVWKKMNAERVSKDSPFGKDFIGCAVDLGRMAQLMYHNGDGHGTQHPIIHQQMTRTLFEPFA* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,858.897 | ||
Theoretical pI: | 9.565 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.543 | ||
aromaticity | 0.121 | ||
GRAVY | -0.053 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.172 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JX555972.1 | complete | 101 | 1206-901(-) |
Amino Acid sequence : | |||
MSKEYAILVKRSPSPPPSFTLSSKNLVANSLADSSVVSPSVNRKEASYSCNNPLVSSLRLSLNSPSSFLKLSNTSAYMPVPNLVKENKFVEWKVWNYIDIG* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,858.897 | ||
Theoretical pI: | 9.565 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.543 | ||
aromaticity | 0.121 | ||
GRAVY | -0.053 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.172 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JX555972.1 | complete | 99 | 880-581(-) |
Amino Acid sequence : | |||
MFSEEPKCKRCGVEIPFFFWKRVLVIVMVEIYRGQDFFELILEMIGQPHPLQVIDQLKLSNLIRFFLQFHLHQSDQLRSPNRVFVLLHTARGGRRKNCQ* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,858.897 | ||
Theoretical pI: | 9.565 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.543 | ||
aromaticity | 0.121 | ||
GRAVY | -0.053 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.172 | ||
sheet | 0.222 |