| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JX856538.1 | 5prime_partial | 127 | 1-384(+) |
Amino Acid sequence : | |||
| AIRPRARLPGCHASLPPPHKPPRGKVSGPGGDWPPVRCPLAVGPNPSLSATEPRRSVVRTSLSSSSRAPASPCQGLADPLHALWAMLASRPQVRRDYPLSLSISISGGKETYQDSPSNGE RTGKSPA* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 12,212.674 | ||
| Theoretical pI: | 11.756 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 63.013 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.690 | ||
Secondary Structure Fraction | |||
| Helix | 0.191 | ||
| turn | 0.339 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JX856538.1 | 5prime_partial | 115 | 3-350(+) |
Amino Acid sequence : | |||
| HQAEGTSAWVSRIVAPPTQTPPGEGVGAGRRLASRALPARGWPKSESFGDRAATIGGENKPLELQSRARVPVSGTRGPFARPLGDARFATPGQAGLPAEFKHINKRRKRNLPGFP* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,212.674 | ||
| Theoretical pI: | 11.756 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 63.013 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.690 | ||
Secondary Structure Fraction | |||
| Helix | 0.191 | ||
| turn | 0.339 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JX856538.1 | 5prime_partial | 127 | 1-384(+) |
Amino Acid sequence : | |||
| AIRPRARLPGCHASLPPPHKPPRGKVSGPGGDWPPVRCPLAVGPNPSLSATEPRRSVVRTSLSSSSRAPASPCQGLADPLHALWAMLASRPQVRRDYPLSLSISISGGKETYQDSPSNGE RTGKSPA* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 12,212.674 | ||
| Theoretical pI: | 11.756 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 63.013 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.690 | ||
Secondary Structure Fraction | |||
| Helix | 0.191 | ||
| turn | 0.339 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JX856538.1 | 5prime_partial | 115 | 3-350(+) |
Amino Acid sequence : | |||
| HQAEGTSAWVSRIVAPPTQTPPGEGVGAGRRLASRALPARGWPKSESFGDRAATIGGENKPLELQSRARVPVSGTRGPFARPLGDARFATPGQAGLPAEFKHINKRRKRNLPGFP* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,212.674 | ||
| Theoretical pI: | 11.756 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 63.013 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.690 | ||
Secondary Structure Fraction | |||
| Helix | 0.191 | ||
| turn | 0.339 | ||
| sheet | 0.243 | ||