Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JX856640.1 | internal | 210 | 3-632(+) |
Amino Acid sequence : | |||
LTYYTPDYVTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIP PAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAE | |||
Physicochemical properties | |||
Number of amino acids: | 210 | ||
Molecular weight: | 23,549.399 | ||
Theoretical pI: | 5.620 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36120 | ||
Instability index: | 32.375 | ||
aromaticity | 0.124 | ||
GRAVY | -0.362 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.224 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JX856640.1 | internal | 210 | 3-632(+) |
Amino Acid sequence : | |||
LTYYTPDYVTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIP PAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAE | |||
Physicochemical properties | |||
Number of amino acids: | 210 | ||
Molecular weight: | 23,549.399 | ||
Theoretical pI: | 5.620 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36120 | ||
Instability index: | 32.375 | ||
aromaticity | 0.124 | ||
GRAVY | -0.362 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.224 | ||
sheet | 0.252 |