| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190506.1 | internal | 283 | 2-850(+) |
Amino Acid sequence : | |||
| LRQQALTMSPTGKAISARPRTTVFQRMPENGNGRNGETRPTHETPLSMPNPAEPESEEKPQKSLNEKQQENQDLLIKCITQDLGFSGGKPVAACVIYKCLLHWRSFEVERTSVFDRIIQA IASSVEVADNNDVLAYWLCNTSTLLMLLQHTLKASGAASLTPQRRRTSSSLLGRMSQGLRSTPQSAGLSFLNSRVLGRLDDLRQVEAKYPALLFKQQLTAYLEKIYGMIRDNLKKEVSPL IGLCIQAPRTSRSSLVKGRSQANAVAQQALIAHWQSIVSALDK | |||
Physicochemical properties | |||
| Number of amino acids: | 283 | ||
| Molecular weight: | 31,356.623 | ||
| Theoretical pI: | 9.705 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
| Instability index: | 53.410 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.370 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.247 | ||
| sheet | 0.283 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190506.1 | internal | 283 | 2-850(+) |
Amino Acid sequence : | |||
| LRQQALTMSPTGKAISARPRTTVFQRMPENGNGRNGETRPTHETPLSMPNPAEPESEEKPQKSLNEKQQENQDLLIKCITQDLGFSGGKPVAACVIYKCLLHWRSFEVERTSVFDRIIQA IASSVEVADNNDVLAYWLCNTSTLLMLLQHTLKASGAASLTPQRRRTSSSLLGRMSQGLRSTPQSAGLSFLNSRVLGRLDDLRQVEAKYPALLFKQQLTAYLEKIYGMIRDNLKKEVSPL IGLCIQAPRTSRSSLVKGRSQANAVAQQALIAHWQSIVSALDK | |||
Physicochemical properties | |||
| Number of amino acids: | 283 | ||
| Molecular weight: | 31,356.623 | ||
| Theoretical pI: | 9.705 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
| Instability index: | 53.410 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.370 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.247 | ||
| sheet | 0.283 | ||