Acc_NO	ORF type	length	start-end position (strand +/-)
>JZ190521.1	5prime_partial	170	1-513(+)
Amino Acid sequence :
TRLANDAKAAKKGGGRQFNGLIDVYRKTLASDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLLTGDLQDSFFASFALGGLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAF AQILKNEGAKSLFKGAGANILRAIAGAGVLAGYDKLQLIVFGKKYGSGGA*
Physicochemical properties
Number of amino acids:		170
Molecular weight:		17,924.573
Theoretical pI:		9.845
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13410 13410
Instability index:		23.377
aromaticity		0.106
GRAVY		0.149
Secondary Structure Fraction
Helix		0.329
turn		0.265
sheet		0.271

Acc_NO	ORF type	length	start-end position (strand +/-)
>JZ190521.1	5prime_partial	170	1-513(+)
Amino Acid sequence :
TRLANDAKAAKKGGGRQFNGLIDVYRKTLASDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLLTGDLQDSFFASFALGGLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAF AQILKNEGAKSLFKGAGANILRAIAGAGVLAGYDKLQLIVFGKKYGSGGA*
Physicochemical properties
Number of amino acids:		170
Molecular weight:		17,924.573
Theoretical pI:		9.845
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13410 13410
Instability index:		23.377
aromaticity		0.106
GRAVY		0.149
Secondary Structure Fraction
Helix		0.329
turn		0.265
sheet		0.271