Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190523.1 | internal | 145 | 3-437(+) |
Amino Acid sequence : | |||
TVTSSEESFDVLRSFVPNASGELKSGERRQSLKTVDRGDQLVVKARQRQEVLSRSARFEQIWRSRKGKKESQEDEDVYDMCRLYDVVRVDVEERSVEVSNQKDADLDDCKMLADFLPLLR EVLPTAAEEIESDIHDVMSGKDGYV | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 16,616.300 | ||
Theoretical pI: | 4.750 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 67.030 | ||
aromaticity | 0.055 | ||
GRAVY | -0.735 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.179 | ||
sheet | 0.262 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190523.1 | internal | 145 | 3-437(+) |
Amino Acid sequence : | |||
TVTSSEESFDVLRSFVPNASGELKSGERRQSLKTVDRGDQLVVKARQRQEVLSRSARFEQIWRSRKGKKESQEDEDVYDMCRLYDVVRVDVEERSVEVSNQKDADLDDCKMLADFLPLLR EVLPTAAEEIESDIHDVMSGKDGYV | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 16,616.300 | ||
Theoretical pI: | 4.750 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 67.030 | ||
aromaticity | 0.055 | ||
GRAVY | -0.735 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.179 | ||
sheet | 0.262 |