| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190527.1 | 5prime_partial | 109 | 1-330(+) |
Amino Acid sequence : | |||
| TMAAIRLSGMEISDLTLELSDLSQEIADGVNKSAQAVQAAEAGVRQIGSLARQQTMAMIQERASLRIISLQPVVAGAAKKTSRAVGQAAKSLMSIISPGEHNSGDEYGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,310.738 | ||
| Theoretical pI: | 5.731 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 45.407 | ||
| aromaticity | 0.009 | ||
| GRAVY | -0.041 | ||
Secondary Structure Fraction | |||
| Helix | 0.229 | ||
| turn | 0.248 | ||
| sheet | 0.349 | ||