Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190527.1 | 5prime_partial | 109 | 1-330(+) |
Amino Acid sequence : | |||
TMAAIRLSGMEISDLTLELSDLSQEIADGVNKSAQAVQAAEAGVRQIGSLARQQTMAMIQERASLRIISLQPVVAGAAKKTSRAVGQAAKSLMSIISPGEHNSGDEYGG* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 11,310.738 | ||
Theoretical pI: | 5.731 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 45.407 | ||
aromaticity | 0.009 | ||
GRAVY | -0.041 | ||
Secondary Structure Fraction | |||
Helix | 0.229 | ||
turn | 0.248 | ||
sheet | 0.349 |