| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190528.1 | 3prime_partial | 178 | 41-574(+) |
Amino Acid sequence : | |||
| MNSLKFISTLLPFLLLLLHAATAIRFDIQNKCSYTIWPAVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDYYD VSVLDGYNLPMEMTPTTNGCTRSVKCAAEDIVANCPSQLKVDGGCQNPCTVFKTTEYC | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 12,651.452 | ||
| Theoretical pI: | 11.170 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 50.912 | ||
| aromaticity | 0.033 | ||
| GRAVY | 0.314 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.157 | ||
| sheet | 0.372 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190528.1 | 5prime_partial | 121 | 574-209(-) |
Amino Acid sequence : | |||
| AILRRFEHRARVLAAAVHLQLTGAIRHDVLRRALDGARAAVSRRRHLHRQIVAVQDGDVVVVLSPEVVEAVLRLGVRRRAEGGAVELAAAVAGEAFALAGGIKGAVGAGPDFGEFGAVLE G* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 12,651.452 | ||
| Theoretical pI: | 11.170 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 50.912 | ||
| aromaticity | 0.033 | ||
| GRAVY | 0.314 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.157 | ||
| sheet | 0.372 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190528.1 | 3prime_partial | 178 | 41-574(+) |
Amino Acid sequence : | |||
| MNSLKFISTLLPFLLLLLHAATAIRFDIQNKCSYTIWPAVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDYYD VSVLDGYNLPMEMTPTTNGCTRSVKCAAEDIVANCPSQLKVDGGCQNPCTVFKTTEYC | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 12,651.452 | ||
| Theoretical pI: | 11.170 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 50.912 | ||
| aromaticity | 0.033 | ||
| GRAVY | 0.314 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.157 | ||
| sheet | 0.372 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190528.1 | 5prime_partial | 121 | 574-209(-) |
Amino Acid sequence : | |||
| AILRRFEHRARVLAAAVHLQLTGAIRHDVLRRALDGARAAVSRRRHLHRQIVAVQDGDVVVVLSPEVVEAVLRLGVRRRAEGGAVELAAAVAGEAFALAGGIKGAVGAGPDFGEFGAVLE G* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 12,651.452 | ||
| Theoretical pI: | 11.170 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 50.912 | ||
| aromaticity | 0.033 | ||
| GRAVY | 0.314 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.157 | ||
| sheet | 0.372 | ||