| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190538.1 | internal | 251 | 1-753(+) |
Amino Acid sequence : | |||
| TNLEKQISTRDAALSTAEQQIKSLQLKFDSAFSNHQSEKEAWERSLQNVEETWRLRCEALERQNEETSSQNLEKEVEKLKLQCKKLKEEQSTFHDLADKMMEEKDKEISRLLDDIENLRQ LLDSRPSVEYSEDQTALHKQEPSNSNTSAAEQQILILARQQAQREEELAQTQRHILALQEEIEELEHENRLHRQQEAMLKEELRNMERTQKREGLDLTYLKNVILKLLETGEVERLLPVI GMLLQFSPDEM | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 29,550.755 | ||
| Theoretical pI: | 4.897 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 68.396 | ||
| aromaticity | 0.032 | ||
| GRAVY | -0.983 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.143 | ||
| sheet | 0.398 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190538.1 | internal | 251 | 1-753(+) |
Amino Acid sequence : | |||
| TNLEKQISTRDAALSTAEQQIKSLQLKFDSAFSNHQSEKEAWERSLQNVEETWRLRCEALERQNEETSSQNLEKEVEKLKLQCKKLKEEQSTFHDLADKMMEEKDKEISRLLDDIENLRQ LLDSRPSVEYSEDQTALHKQEPSNSNTSAAEQQILILARQQAQREEELAQTQRHILALQEEIEELEHENRLHRQQEAMLKEELRNMERTQKREGLDLTYLKNVILKLLETGEVERLLPVI GMLLQFSPDEM | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 29,550.755 | ||
| Theoretical pI: | 4.897 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 68.396 | ||
| aromaticity | 0.032 | ||
| GRAVY | -0.983 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.143 | ||
| sheet | 0.398 | ||