| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190539.1 | internal | 157 | 3-473(+) |
Amino Acid sequence : | |||
| RSLVYLLDMKTGSRSKGATKKETKETLKPVDDRKVGKRKAAPKAAPRKAKKEKTKDPNKPKRPPSAFFVFLEEFRKTFKKENPNVKAVSAVGKAGGEKWKSLSEDEKAPYEAKAAKKKAE YEKLMNAYNKKQQESSADEGDDASEKSASEVHDDEES | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 17,564.657 | ||
| Theoretical pI: | 9.625 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 38.717 | ||
| aromaticity | 0.064 | ||
| GRAVY | -1.348 | ||
Secondary Structure Fraction | |||
| Helix | 0.159 | ||
| turn | 0.217 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190539.1 | internal | 157 | 3-473(+) |
Amino Acid sequence : | |||
| RSLVYLLDMKTGSRSKGATKKETKETLKPVDDRKVGKRKAAPKAAPRKAKKEKTKDPNKPKRPPSAFFVFLEEFRKTFKKENPNVKAVSAVGKAGGEKWKSLSEDEKAPYEAKAAKKKAE YEKLMNAYNKKQQESSADEGDDASEKSASEVHDDEES | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 17,564.657 | ||
| Theoretical pI: | 9.625 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 38.717 | ||
| aromaticity | 0.064 | ||
| GRAVY | -1.348 | ||
Secondary Structure Fraction | |||
| Helix | 0.159 | ||
| turn | 0.217 | ||
| sheet | 0.293 | ||