| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190543.1 | internal | 124 | 3-374(+) |
Amino Acid sequence : | |||
| KNTSEAAVDGVKMIVESCIRSKTVKRLIYTATVMAAAPLKDDGAGYEDVMDENCWTPLNVSYPMFSDYINSKTLTEKEVLSYNGKGIEVVSLACALVGGDTVKSSISDSVKILISQALKN EEFL | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,434.248 | ||
| Theoretical pI: | 4.805 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 34.498 | ||
| aromaticity | 0.065 | ||
| GRAVY | 0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.234 | ||
| sheet | 0.266 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190543.1 | internal | 124 | 3-374(+) |
Amino Acid sequence : | |||
| KNTSEAAVDGVKMIVESCIRSKTVKRLIYTATVMAAAPLKDDGAGYEDVMDENCWTPLNVSYPMFSDYINSKTLTEKEVLSYNGKGIEVVSLACALVGGDTVKSSISDSVKILISQALKN EEFL | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,434.248 | ||
| Theoretical pI: | 4.805 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 34.498 | ||
| aromaticity | 0.065 | ||
| GRAVY | 0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.234 | ||
| sheet | 0.266 | ||