| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190561.1 | 5prime_partial | 217 | 3-656(+) |
Amino Acid sequence : | |||
| IEIYKPLPSNGSILNKAAISGFHDKGKAAIVDVEILSYEKDSGVLLCMQRMTIYLRGAGGFSKSSQPYSFTKNPSHQTPTYKIPNSQPFAVFEECTHPSQALLYSLSGDYNPLHSDPRIA QIAGFSRPILHGLCTLGFAVRAIISSICRGDQNMVQNITGRFLLHVYPGETLITEMWVEGLRVVYHVKVKERNKAALSRCCNSKSLHLISVISHIAD* | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 23,978.394 | ||
| Theoretical pI: | 9.016 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19285 | ||
| Instability index: | 39.902 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.272 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190561.1 | 5prime_partial | 217 | 3-656(+) |
Amino Acid sequence : | |||
| IEIYKPLPSNGSILNKAAISGFHDKGKAAIVDVEILSYEKDSGVLLCMQRMTIYLRGAGGFSKSSQPYSFTKNPSHQTPTYKIPNSQPFAVFEECTHPSQALLYSLSGDYNPLHSDPRIA QIAGFSRPILHGLCTLGFAVRAIISSICRGDQNMVQNITGRFLLHVYPGETLITEMWVEGLRVVYHVKVKERNKAALSRCCNSKSLHLISVISHIAD* | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 23,978.394 | ||
| Theoretical pI: | 9.016 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19285 | ||
| Instability index: | 39.902 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.272 | ||
| sheet | 0.217 | ||