| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190578.1 | internal | 170 | 511-2(-) |
Amino Acid sequence : | |||
| LLLTKPISLVYVVDDIFDLYGQLHELTLFTQAVVRWDASATEQLPSYMKTCLDAIHDTTNEISRFVSQEYGWNPIHFLIKEWGSLMEAFVIEAKWFRSVGCANSDEYFKNGVISSGVPMV LSHLFCLMGDPLTIQSQTLLNDPNGLTHSVAKLLRLLDDLGSAKDEEQEG | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 19,127.592 | ||
| Theoretical pI: | 4.607 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 35.474 | ||
| aromaticity | 0.100 | ||
| GRAVY | 0.039 | ||
Secondary Structure Fraction | |||
| Helix | 0.365 | ||
| turn | 0.212 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190578.1 | internal | 170 | 511-2(-) |
Amino Acid sequence : | |||
| LLLTKPISLVYVVDDIFDLYGQLHELTLFTQAVVRWDASATEQLPSYMKTCLDAIHDTTNEISRFVSQEYGWNPIHFLIKEWGSLMEAFVIEAKWFRSVGCANSDEYFKNGVISSGVPMV LSHLFCLMGDPLTIQSQTLLNDPNGLTHSVAKLLRLLDDLGSAKDEEQEG | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 19,127.592 | ||
| Theoretical pI: | 4.607 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 35.474 | ||
| aromaticity | 0.100 | ||
| GRAVY | 0.039 | ||
Secondary Structure Fraction | |||
| Helix | 0.365 | ||
| turn | 0.212 | ||
| sheet | 0.282 | ||