| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190590.1 | 5prime_partial | 146 | 3-443(+) |
Amino Acid sequence : | |||
| KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI QSTCATSGEGLYEGLDWLSNNIANKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 16,745.680 | ||
| Theoretical pI: | 5.328 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
| Instability index: | 36.375 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.397 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.199 | ||
| sheet | 0.253 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190590.1 | 5prime_partial | 146 | 3-443(+) |
Amino Acid sequence : | |||
| KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI QSTCATSGEGLYEGLDWLSNNIANKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 16,745.680 | ||
| Theoretical pI: | 5.328 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
| Instability index: | 36.375 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.397 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.199 | ||
| sheet | 0.253 | ||