Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190593.1 | 5prime_partial | 164 | 504-10(-) |
Amino Acid sequence : | |||
LITSWVVIAILLGSVTIAVRNPQTIPTGGQNFFEYVLEFIRDVSQTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKIIELPHGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLS YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVVH* | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 18,205.030 | ||
Theoretical pI: | 5.001 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 30940 | ||
Instability index: | 28.514 | ||
aromaticity | 0.134 | ||
GRAVY | 0.577 | ||
Secondary Structure Fraction | |||
Helix | 0.451 | ||
turn | 0.244 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190593.1 | 5prime_partial | 164 | 504-10(-) |
Amino Acid sequence : | |||
LITSWVVIAILLGSVTIAVRNPQTIPTGGQNFFEYVLEFIRDVSQTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKIIELPHGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLS YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVVH* | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 18,205.030 | ||
Theoretical pI: | 5.001 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 30940 | ||
Instability index: | 28.514 | ||
aromaticity | 0.134 | ||
GRAVY | 0.577 | ||
Secondary Structure Fraction | |||
Helix | 0.451 | ||
turn | 0.244 | ||
sheet | 0.250 |