| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190596.1 | 3prime_partial | 104 | 3-314(+) |
Amino Acid sequence : | |||
| MRTLEILSKKLKFVEIDTMVKTSKALNDVQPELEKLRQKAVSKVFEFMVQKLNALRKPKTNVQILQQSVLLKYKYVILFLKEHGKEVFLDVRAAYIDTMNKVLS | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 12,170.461 | ||
| Theoretical pI: | 9.859 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 24.599 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.112 | ||
Secondary Structure Fraction | |||
| Helix | 0.385 | ||
| turn | 0.115 | ||
| sheet | 0.298 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190596.1 | 3prime_partial | 104 | 3-314(+) |
Amino Acid sequence : | |||
| MRTLEILSKKLKFVEIDTMVKTSKALNDVQPELEKLRQKAVSKVFEFMVQKLNALRKPKTNVQILQQSVLLKYKYVILFLKEHGKEVFLDVRAAYIDTMNKVLS | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 12,170.461 | ||
| Theoretical pI: | 9.859 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 24.599 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.112 | ||
Secondary Structure Fraction | |||
| Helix | 0.385 | ||
| turn | 0.115 | ||
| sheet | 0.298 | ||