| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190601.1 | internal | 150 | 2-451(+) |
Amino Acid sequence : | |||
| QNLGGASGFRKGMDLYFKRHDGQAVTCEDFFAAMRDANGADFSNFLLWYSQAGTPRLKVVSNYNAEAKTYSLKFSQEVPPTPGQPVKEPMFIPVALGLLGSDGKDVPLSSIYHDGKLEAV SNTDQPGHTVVLRVTKKEEEFVFVDIPERP | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 16,541.464 | ||
| Theoretical pI: | 5.595 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 25.856 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.383 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.267 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190601.1 | internal | 150 | 2-451(+) |
Amino Acid sequence : | |||
| QNLGGASGFRKGMDLYFKRHDGQAVTCEDFFAAMRDANGADFSNFLLWYSQAGTPRLKVVSNYNAEAKTYSLKFSQEVPPTPGQPVKEPMFIPVALGLLGSDGKDVPLSSIYHDGKLEAV SNTDQPGHTVVLRVTKKEEEFVFVDIPERP | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 16,541.464 | ||
| Theoretical pI: | 5.595 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 25.856 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.383 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.267 | ||
| sheet | 0.233 | ||