| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190604.1 | internal | 112 | 1-336(+) |
Amino Acid sequence : | |||
| SRPRYKAWTACEKTGCVGDQCFQHCNFSSDGNPIDGPWYLQEPLYIQWKQWDCRSDCRYHCMLSREEERQKLGYKPVKYHGKWPFKRIYGIQEPVSVAFSALNLAVRPGANG | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,964.249 | ||
| Theoretical pI: | 11.564 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 34.814 | ||
| aromaticity | 0.116 | ||
| GRAVY | 0.123 | ||
Secondary Structure Fraction | |||
| Helix | 0.384 | ||
| turn | 0.214 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190604.1 | internal | 112 | 336-1(-) |
Amino Acid sequence : | |||
| TVRARSYGKIKRRESYRDWFLDPINSFERPFAMVFHRLVAKFLSFFFSREHAMVTTVTAAVPLLPLNVKWLLQIPWAINRVSIRGKITVLKALVPHTSSLLTCSPSLVPRPR | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,964.249 | ||
| Theoretical pI: | 11.564 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 34.814 | ||
| aromaticity | 0.116 | ||
| GRAVY | 0.123 | ||
Secondary Structure Fraction | |||
| Helix | 0.384 | ||
| turn | 0.214 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190604.1 | internal | 112 | 1-336(+) |
Amino Acid sequence : | |||
| SRPRYKAWTACEKTGCVGDQCFQHCNFSSDGNPIDGPWYLQEPLYIQWKQWDCRSDCRYHCMLSREEERQKLGYKPVKYHGKWPFKRIYGIQEPVSVAFSALNLAVRPGANG | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,964.249 | ||
| Theoretical pI: | 11.564 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 34.814 | ||
| aromaticity | 0.116 | ||
| GRAVY | 0.123 | ||
Secondary Structure Fraction | |||
| Helix | 0.384 | ||
| turn | 0.214 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190604.1 | internal | 112 | 336-1(-) |
Amino Acid sequence : | |||
| TVRARSYGKIKRRESYRDWFLDPINSFERPFAMVFHRLVAKFLSFFFSREHAMVTTVTAAVPLLPLNVKWLLQIPWAINRVSIRGKITVLKALVPHTSSLLTCSPSLVPRPR | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,964.249 | ||
| Theoretical pI: | 11.564 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 34.814 | ||
| aromaticity | 0.116 | ||
| GRAVY | 0.123 | ||
Secondary Structure Fraction | |||
| Helix | 0.384 | ||
| turn | 0.214 | ||
| sheet | 0.232 | ||