| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190617.1 | 3prime_partial | 110 | 331-2(-) |
Amino Acid sequence : | |||
| MLDKMMRVEKLVMEVGSSLEITEDTLRVVHDAASLAMSDLSTAVVTEFTSLSGLMARHYALRDGYSEQIADALYEIMLPRFSGDMLPKTVAGTVLAIADRLDSLIGLFAA | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 11,969.788 | ||
| Theoretical pI: | 4.585 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 38.105 | ||
| aromaticity | 0.055 | ||
| GRAVY | 0.374 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.164 | ||
| sheet | 0.400 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190617.1 | 3prime_partial | 110 | 331-2(-) |
Amino Acid sequence : | |||
| MLDKMMRVEKLVMEVGSSLEITEDTLRVVHDAASLAMSDLSTAVVTEFTSLSGLMARHYALRDGYSEQIADALYEIMLPRFSGDMLPKTVAGTVLAIADRLDSLIGLFAA | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 11,969.788 | ||
| Theoretical pI: | 4.585 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 38.105 | ||
| aromaticity | 0.055 | ||
| GRAVY | 0.374 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.164 | ||
| sheet | 0.400 | ||