Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190617.1 | 3prime_partial | 110 | 331-2(-) |
Amino Acid sequence : | |||
MLDKMMRVEKLVMEVGSSLEITEDTLRVVHDAASLAMSDLSTAVVTEFTSLSGLMARHYALRDGYSEQIADALYEIMLPRFSGDMLPKTVAGTVLAIADRLDSLIGLFAA | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 11,969.788 | ||
Theoretical pI: | 4.585 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 38.105 | ||
aromaticity | 0.055 | ||
GRAVY | 0.374 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.164 | ||
sheet | 0.400 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190617.1 | 3prime_partial | 110 | 331-2(-) |
Amino Acid sequence : | |||
MLDKMMRVEKLVMEVGSSLEITEDTLRVVHDAASLAMSDLSTAVVTEFTSLSGLMARHYALRDGYSEQIADALYEIMLPRFSGDMLPKTVAGTVLAIADRLDSLIGLFAA | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 11,969.788 | ||
Theoretical pI: | 4.585 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 38.105 | ||
aromaticity | 0.055 | ||
GRAVY | 0.374 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.164 | ||
sheet | 0.400 |