| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190619.1 | 3prime_partial | 157 | 472-2(-) |
Amino Acid sequence : | |||
| MRRWPLNKIRQKAMDKAIKYMRYGAEESRYITIGCVEKSLQMMCWWAHDPNCDEFKHHLARVPDYLWLAEDGMKMQSFGSQLWDSALATQAVISTGMVEEYGDCLKKAHFYIKESQVKEN PKGDFTAMYRHFTKGSWTFSDQDQGWVVSDCTAEALK | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 18,336.786 | ||
| Theoretical pI: | 6.948 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 48930 49180 | ||
| Instability index: | 42.219 | ||
| aromaticity | 0.127 | ||
| GRAVY | -0.586 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.166 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190619.1 | 3prime_partial | 157 | 472-2(-) |
Amino Acid sequence : | |||
| MRRWPLNKIRQKAMDKAIKYMRYGAEESRYITIGCVEKSLQMMCWWAHDPNCDEFKHHLARVPDYLWLAEDGMKMQSFGSQLWDSALATQAVISTGMVEEYGDCLKKAHFYIKESQVKEN PKGDFTAMYRHFTKGSWTFSDQDQGWVVSDCTAEALK | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 18,336.786 | ||
| Theoretical pI: | 6.948 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 48930 49180 | ||
| Instability index: | 42.219 | ||
| aromaticity | 0.127 | ||
| GRAVY | -0.586 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.166 | ||
| sheet | 0.261 | ||