| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190620.1 | 5prime_partial | 237 | 1-714(+) |
Amino Acid sequence : | |||
| TSVRSVYTSASAMKNTPLKLSYVYQCTGCDSFHLQPVGRTISKNTSVRYLPGFGPAVAQECSDCGKKYNMGGPIWSAPIHDMEWVTSTLADVKSMKDRYPAFDRISAVLTAISEELPDAP LFLSLHNLCATLKCTSPAAVIFRSAVINAGYRISGTHVCPLGLKTDAPMDVIWDIMRCWVKNHPVKAQPPDQAGSVILAKEPVLQANFARAVASLSKAQRKRLQDFSRTQRGIGGRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 15,435.491 | ||
| Theoretical pI: | 9.645 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
| Instability index: | 31.560 | ||
| aromaticity | 0.099 | ||
| GRAVY | 0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.277 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190620.1 | complete | 141 | 527-102(-) |
Amino Acid sequence : | |||
| MISHITSIGASVFKPSGQTWVPDIRYPAFITAERNITAAGDVHFKVAQRLCRLRNRGASGSSSEIAVNTAEIRSKAGYRSFMDFTSARVEVTHSISWIGADHMGPPILYFLPQSLHSWAT AGPNPGRYLTLVFLEMVLPTG* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,435.491 | ||
| Theoretical pI: | 9.645 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
| Instability index: | 31.560 | ||
| aromaticity | 0.099 | ||
| GRAVY | 0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.277 | ||
| sheet | 0.227 | ||