Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190620.1 | 5prime_partial | 237 | 1-714(+) |
Amino Acid sequence : | |||
TSVRSVYTSASAMKNTPLKLSYVYQCTGCDSFHLQPVGRTISKNTSVRYLPGFGPAVAQECSDCGKKYNMGGPIWSAPIHDMEWVTSTLADVKSMKDRYPAFDRISAVLTAISEELPDAP LFLSLHNLCATLKCTSPAAVIFRSAVINAGYRISGTHVCPLGLKTDAPMDVIWDIMRCWVKNHPVKAQPPDQAGSVILAKEPVLQANFARAVASLSKAQRKRLQDFSRTQRGIGGRR* | |||
Physicochemical properties | |||
Number of amino acids: | 237 | ||
Molecular weight: | 15,435.491 | ||
Theoretical pI: | 9.645 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
Instability index: | 31.560 | ||
aromaticity | 0.099 | ||
GRAVY | 0.014 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.277 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190620.1 | complete | 141 | 527-102(-) |
Amino Acid sequence : | |||
MISHITSIGASVFKPSGQTWVPDIRYPAFITAERNITAAGDVHFKVAQRLCRLRNRGASGSSSEIAVNTAEIRSKAGYRSFMDFTSARVEVTHSISWIGADHMGPPILYFLPQSLHSWAT AGPNPGRYLTLVFLEMVLPTG* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,435.491 | ||
Theoretical pI: | 9.645 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
Instability index: | 31.560 | ||
aromaticity | 0.099 | ||
GRAVY | 0.014 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.277 | ||
sheet | 0.227 |