| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190628.1 | internal | 236 | 2-709(+) |
Amino Acid sequence : | |||
| LVIVMDHDSNSEKQTSNRIPDYNSDTHGPLLHSSTTPAIQTGRQEFTFSPTQNRDISHPIPVRGVRFGDVVNTYGSVIPTTYCEKSGSSPLTSPGSNHPSESFQQSNPFYPLDRQPLSSQ QLHSPVDQRNCDSVDQSENKQGRKLKNVEEQGLISPGTNHSANSSFCNGNLNHQSQGSGCNGTINAVSVTKVPSECGSGHEESFHLHEGASHRAMQREAALTKFRLKRKDRCFEKK | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 25,973.140 | ||
| Theoretical pI: | 7.318 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 48.734 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.920 | ||
Secondary Structure Fraction | |||
| Helix | 0.199 | ||
| turn | 0.352 | ||
| sheet | 0.148 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190628.1 | internal | 236 | 2-709(+) |
Amino Acid sequence : | |||
| LVIVMDHDSNSEKQTSNRIPDYNSDTHGPLLHSSTTPAIQTGRQEFTFSPTQNRDISHPIPVRGVRFGDVVNTYGSVIPTTYCEKSGSSPLTSPGSNHPSESFQQSNPFYPLDRQPLSSQ QLHSPVDQRNCDSVDQSENKQGRKLKNVEEQGLISPGTNHSANSSFCNGNLNHQSQGSGCNGTINAVSVTKVPSECGSGHEESFHLHEGASHRAMQREAALTKFRLKRKDRCFEKK | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 25,973.140 | ||
| Theoretical pI: | 7.318 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 48.734 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.920 | ||
Secondary Structure Fraction | |||
| Helix | 0.199 | ||
| turn | 0.352 | ||
| sheet | 0.148 | ||