| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190634.1 | internal | 103 | 310-2(-) |
Amino Acid sequence : | |||
| AISPSSSTVMAIISPTLIPLDPSPRSIFARYPSSMHSISTVALSVSTSQSTSPGETLSPSFFNHFAILPSVIVGEREGIPISWCGGRPESDENCLTPFLDLLL | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 10,939.222 | ||
| Theoretical pI: | 4.594 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 56.021 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.461 | ||
Secondary Structure Fraction | |||
| Helix | 0.235 | ||
| turn | 0.294 | ||
| sheet | 0.275 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190634.1 | internal | 102 | 3-308(+) |
Amino Acid sequence : | |||
| NSKSKNGVRQFSSDSGLPPHQEIGMPSLSPTMTEGNIAKWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKILRGDGSSGIKVGEIIAITVEEEGDI | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 10,939.222 | ||
| Theoretical pI: | 4.594 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 56.021 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.461 | ||
Secondary Structure Fraction | |||
| Helix | 0.235 | ||
| turn | 0.294 | ||
| sheet | 0.275 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190634.1 | internal | 103 | 310-2(-) |
Amino Acid sequence : | |||
| AISPSSSTVMAIISPTLIPLDPSPRSIFARYPSSMHSISTVALSVSTSQSTSPGETLSPSFFNHFAILPSVIVGEREGIPISWCGGRPESDENCLTPFLDLLL | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 10,939.222 | ||
| Theoretical pI: | 4.594 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 56.021 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.461 | ||
Secondary Structure Fraction | |||
| Helix | 0.235 | ||
| turn | 0.294 | ||
| sheet | 0.275 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190634.1 | internal | 102 | 3-308(+) |
Amino Acid sequence : | |||
| NSKSKNGVRQFSSDSGLPPHQEIGMPSLSPTMTEGNIAKWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKILRGDGSSGIKVGEIIAITVEEEGDI | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 10,939.222 | ||
| Theoretical pI: | 4.594 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 56.021 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.461 | ||
Secondary Structure Fraction | |||
| Helix | 0.235 | ||
| turn | 0.294 | ||
| sheet | 0.275 | ||