| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190658.1 | 5prime_partial | 108 | 465-139(-) |
Amino Acid sequence : | |||
| TPPIVSLPPSQFHSPALTPRGTNRKTPRIRTPRFITPLGSPIRKAIKLTKLDPQDAWLPITESRNGNAYYAAYHTLCSGIGIQALILPVAFTILGWTWAVIGLSLTFI* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 11,861.776 | ||
| Theoretical pI: | 10.651 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
| Instability index: | 38.102 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.119 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.278 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190658.1 | 5prime_partial | 108 | 465-139(-) |
Amino Acid sequence : | |||
| TPPIVSLPPSQFHSPALTPRGTNRKTPRIRTPRFITPLGSPIRKAIKLTKLDPQDAWLPITESRNGNAYYAAYHTLCSGIGIQALILPVAFTILGWTWAVIGLSLTFI* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 11,861.776 | ||
| Theoretical pI: | 10.651 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
| Instability index: | 38.102 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.119 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.278 | ||
| sheet | 0.204 | ||