| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190659.1 | 5prime_partial | 217 | 3-656(+) |
Amino Acid sequence : | |||
| DSVWILLKELANSAQHRAIARKTSMPKSSTGVLGLQLHKVRAIQSNIDDFTHHMSELLRIERDAELEFTQEELNAFPTPPDDPSAPAKPIEFLVSHSQAEQELCDTICNLYAVSTYIGLG GMHLVLFRIDGNHRLPPTNLSPGDMVCVRICDSRGAGATSCMQGVVNNLGDDGCSITVALESRHGDPTFSKLFGKNIRIDRIQDWLMHSRMSVTVKL* | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 13,171.046 | ||
| Theoretical pI: | 11.755 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 88.329 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.311 | ||
Secondary Structure Fraction | |||
| Helix | 0.244 | ||
| turn | 0.387 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190659.1 | 5prime_partial | 119 | 1-360(+) |
Amino Acid sequence : | |||
| TTQFGFCSRSSPIQLSIELLRGRLPCRNPPPVFSVYSSTRSEPFSPTSTTSPTTCLSCSASKGMRSWNSLRKSSTLFQRLLMTPPLLRSRLSSWSAIRRRSKNSVIPSAISMPSARISD* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,171.046 | ||
| Theoretical pI: | 11.755 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 88.329 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.311 | ||
Secondary Structure Fraction | |||
| Helix | 0.244 | ||
| turn | 0.387 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190659.1 | 5prime_partial | 217 | 3-656(+) |
Amino Acid sequence : | |||
| DSVWILLKELANSAQHRAIARKTSMPKSSTGVLGLQLHKVRAIQSNIDDFTHHMSELLRIERDAELEFTQEELNAFPTPPDDPSAPAKPIEFLVSHSQAEQELCDTICNLYAVSTYIGLG GMHLVLFRIDGNHRLPPTNLSPGDMVCVRICDSRGAGATSCMQGVVNNLGDDGCSITVALESRHGDPTFSKLFGKNIRIDRIQDWLMHSRMSVTVKL* | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 13,171.046 | ||
| Theoretical pI: | 11.755 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 88.329 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.311 | ||
Secondary Structure Fraction | |||
| Helix | 0.244 | ||
| turn | 0.387 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190659.1 | 5prime_partial | 119 | 1-360(+) |
Amino Acid sequence : | |||
| TTQFGFCSRSSPIQLSIELLRGRLPCRNPPPVFSVYSSTRSEPFSPTSTTSPTTCLSCSASKGMRSWNSLRKSSTLFQRLLMTPPLLRSRLSSWSAIRRRSKNSVIPSAISMPSARISD* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,171.046 | ||
| Theoretical pI: | 11.755 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 88.329 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.311 | ||
Secondary Structure Fraction | |||
| Helix | 0.244 | ||
| turn | 0.387 | ||
| sheet | 0.176 | ||