Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190662.1 | internal | 249 | 1-747(+) |
Amino Acid sequence : | |||
TSSCRVTKRPQGTGFLKFKTVDAANAALSAADAVTPGILIKGRPVKVLKALDKKTAHDKALEKEKAKKEDSDHRNVYLAKEGLITEEMPAAMGVSASDMSKRKKLHEDKMSKLQSPNFRV SKTRLIVYNVPKSMHEKDLKKLFIDAVTSRATKQKPTILQIKILKDTKKGKEGEKSRPRGVAFLEFTEHQHALVALRVLNNNPDTFGAEHRPIVEFALDNVQKLKLRAEKLKAQQQEQGL HTATPNSQP | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 27,747.847 | ||
Theoretical pI: | 9.954 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 35.506 | ||
aromaticity | 0.040 | ||
GRAVY | -0.668 | ||
Secondary Structure Fraction | |||
Helix | 0.237 | ||
turn | 0.185 | ||
sheet | 0.281 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190662.1 | internal | 249 | 1-747(+) |
Amino Acid sequence : | |||
TSSCRVTKRPQGTGFLKFKTVDAANAALSAADAVTPGILIKGRPVKVLKALDKKTAHDKALEKEKAKKEDSDHRNVYLAKEGLITEEMPAAMGVSASDMSKRKKLHEDKMSKLQSPNFRV SKTRLIVYNVPKSMHEKDLKKLFIDAVTSRATKQKPTILQIKILKDTKKGKEGEKSRPRGVAFLEFTEHQHALVALRVLNNNPDTFGAEHRPIVEFALDNVQKLKLRAEKLKAQQQEQGL HTATPNSQP | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 27,747.847 | ||
Theoretical pI: | 9.954 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 35.506 | ||
aromaticity | 0.040 | ||
GRAVY | -0.668 | ||
Secondary Structure Fraction | |||
Helix | 0.237 | ||
turn | 0.185 | ||
sheet | 0.281 |