| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190665.1 | internal | 182 | 2-547(+) |
Amino Acid sequence : | |||
| LYKLDELVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLSKAAGLATMIAAMRPDIDNIDEYVRNTTARAFSVVASALGIPALLPFLKAVCQSKKSWQARHTGIKIVQQIAILIGCAV LPHLRSLVEIIEHGLNDENQKVRTITALSLAALAEAAAPYGIESFDSVLKPLWKGIRSHRGK | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 20,091.287 | ||
| Theoretical pI: | 8.874 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 39.806 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.197 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.181 | ||
| sheet | 0.313 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190665.1 | internal | 182 | 2-547(+) |
Amino Acid sequence : | |||
| LYKLDELVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLSKAAGLATMIAAMRPDIDNIDEYVRNTTARAFSVVASALGIPALLPFLKAVCQSKKSWQARHTGIKIVQQIAILIGCAV LPHLRSLVEIIEHGLNDENQKVRTITALSLAALAEAAAPYGIESFDSVLKPLWKGIRSHRGK | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 20,091.287 | ||
| Theoretical pI: | 8.874 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 39.806 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.197 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.181 | ||
| sheet | 0.313 | ||