| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190666.1 | internal | 165 | 3-497(+) |
Amino Acid sequence : | |||
| YVMDPEKAVEMVEENTICVAAILGSTLNGEFEDVKRLNDLLLEKNKQTGWDTPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEELIFHINYL GADQPTFTLNFSKGSSQVIAQYYQFIRLGHEGYRNIMENCQENAM | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 18,820.148 | ||
| Theoretical pI: | 4.766 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34045 | ||
| Instability index: | 36.707 | ||
| aromaticity | 0.121 | ||
| GRAVY | -0.198 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.230 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190666.1 | internal | 165 | 3-497(+) |
Amino Acid sequence : | |||
| YVMDPEKAVEMVEENTICVAAILGSTLNGEFEDVKRLNDLLLEKNKQTGWDTPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEELIFHINYL GADQPTFTLNFSKGSSQVIAQYYQFIRLGHEGYRNIMENCQENAM | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 18,820.148 | ||
| Theoretical pI: | 4.766 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34045 | ||
| Instability index: | 36.707 | ||
| aromaticity | 0.121 | ||
| GRAVY | -0.198 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.230 | ||
| sheet | 0.273 | ||