| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190672.1 | internal | 206 | 620-3(-) |
Amino Acid sequence : | |||
| PQLHVFLKQVVGLDLVDDESKRERRPTKHMPTPDQWTNIFNPAFSYYSYYCYANLYTLNKLRESKGMTTIKFRPHSGEAGDIDHLAATFLLADSIAHGINLRKSPVLQYLYYLAQIGLAM SPLSNNSLFLDYHRNPFPMFFLRGLNVSLSTDDPLQIHLTKEPLVEEYSIAASVWKLSSCDLCEIARNSVYQSGFSHALKSPLRQG | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 23,490.555 | ||
| Theoretical pI: | 8.148 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
| Instability index: | 51.325 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.252 | ||
Secondary Structure Fraction | |||
| Helix | 0.340 | ||
| turn | 0.252 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190672.1 | internal | 206 | 620-3(-) |
Amino Acid sequence : | |||
| PQLHVFLKQVVGLDLVDDESKRERRPTKHMPTPDQWTNIFNPAFSYYSYYCYANLYTLNKLRESKGMTTIKFRPHSGEAGDIDHLAATFLLADSIAHGINLRKSPVLQYLYYLAQIGLAM SPLSNNSLFLDYHRNPFPMFFLRGLNVSLSTDDPLQIHLTKEPLVEEYSIAASVWKLSSCDLCEIARNSVYQSGFSHALKSPLRQG | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 23,490.555 | ||
| Theoretical pI: | 8.148 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
| Instability index: | 51.325 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.252 | ||
Secondary Structure Fraction | |||
| Helix | 0.340 | ||
| turn | 0.252 | ||
| sheet | 0.257 | ||