| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190683.1 | internal | 225 | 676-2(-) |
Amino Acid sequence : | |||
| KGEMGDGSRIAVKRLAKDNSNPTKEKEFLMELGIIGHVNHPNTAKLVGYCIESGLYLVFHLYPNGTLSSALHGEGRQGLEWGARFRIVIGIARGLHYLHKCCKHRIIHRDIKASNVLLGP NYDPQISDFGLAKWLPSKWSHHAVIPVEGTFGYLAPEYFMHGIVDEKTDVFAFGILLLEILTGRRPVDSNTQISLLLWARPLMESGNLKELADPMMKGRFDMEQL | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 25,259.005 | ||
| Theoretical pI: | 8.414 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32555 | ||
| Instability index: | 26.765 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.148 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.244 | ||
| sheet | 0.276 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190683.1 | internal | 225 | 676-2(-) |
Amino Acid sequence : | |||
| KGEMGDGSRIAVKRLAKDNSNPTKEKEFLMELGIIGHVNHPNTAKLVGYCIESGLYLVFHLYPNGTLSSALHGEGRQGLEWGARFRIVIGIARGLHYLHKCCKHRIIHRDIKASNVLLGP NYDPQISDFGLAKWLPSKWSHHAVIPVEGTFGYLAPEYFMHGIVDEKTDVFAFGILLLEILTGRRPVDSNTQISLLLWARPLMESGNLKELADPMMKGRFDMEQL | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 25,259.005 | ||
| Theoretical pI: | 8.414 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32555 | ||
| Instability index: | 26.765 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.148 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.244 | ||
| sheet | 0.276 | ||