| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190685.1 | internal | 212 | 638-3(-) |
Amino Acid sequence : | |||
| PPRPGDFSRNRSGRGLLPSFSFRKKKPVSDGERSSLLSSDSKAALESPAFSEISPWPKCASLPVTPASNLSPLASARTQSERQRSHETSRKVVSRSLSVPGRRSYFIVRSLSLNRENHAS DANGDQINPVPEDEEIPEEEAVCRICLDTCEERDTLKMECLCKGALNLVHTECAIKWFSLRRNRVCEVCGKEVSNLPVTLLRIAPPSQPEPN | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 23,483.313 | ||
| Theoretical pI: | 8.665 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
| Instability index: | 77.390 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.600 | ||
Secondary Structure Fraction | |||
| Helix | 0.231 | ||
| turn | 0.321 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190685.1 | internal | 212 | 638-3(-) |
Amino Acid sequence : | |||
| PPRPGDFSRNRSGRGLLPSFSFRKKKPVSDGERSSLLSSDSKAALESPAFSEISPWPKCASLPVTPASNLSPLASARTQSERQRSHETSRKVVSRSLSVPGRRSYFIVRSLSLNRENHAS DANGDQINPVPEDEEIPEEEAVCRICLDTCEERDTLKMECLCKGALNLVHTECAIKWFSLRRNRVCEVCGKEVSNLPVTLLRIAPPSQPEPN | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 23,483.313 | ||
| Theoretical pI: | 8.665 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
| Instability index: | 77.390 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.600 | ||
Secondary Structure Fraction | |||
| Helix | 0.231 | ||
| turn | 0.321 | ||
| sheet | 0.250 | ||