| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190690.1 | 5prime_partial | 199 | 3-602(+) |
Amino Acid sequence : | |||
| DEADDYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKENRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDKIV EFTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGLSNALDGSYSKAGQPELMFAAAENDEVVDA* | |||
Physicochemical properties | |||
| Number of amino acids: | 199 | ||
| Molecular weight: | 11,987.114 | ||
| Theoretical pI: | 11.606 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 110.566 | ||
| aromaticity | 0.030 | ||
| GRAVY | -1.782 | ||
Secondary Structure Fraction | |||
| Helix | 0.139 | ||
| turn | 0.188 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190690.1 | complete | 106 | 337-17(-) |
Amino Acid sequence : | |||
| MSSAFIPGTESIIPIDFSRLTPVAPNGPSWPQELTTTFASITFGSIHDCVSWFIDTSAQFVTTPATLFSFTIKSSAATALKSFTFGRARSLLMMVEVKSAACLITT* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,987.114 | ||
| Theoretical pI: | 11.606 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 110.566 | ||
| aromaticity | 0.030 | ||
| GRAVY | -1.782 | ||
Secondary Structure Fraction | |||
| Helix | 0.139 | ||
| turn | 0.188 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190690.1 | 5prime_partial | 101 | 2-307(+) |
Amino Acid sequence : | |||
| RRGGRLRRDQTRRAFHLHHHEQAPRPAEREALQRRRRRGFDRERKQSRRSCDELGAGVDEPRHTVVYGPERDGGEGGGELLRPRRAVRRHRRQAAEVDRND* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,987.114 | ||
| Theoretical pI: | 11.606 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 110.566 | ||
| aromaticity | 0.030 | ||
| GRAVY | -1.782 | ||
Secondary Structure Fraction | |||
| Helix | 0.139 | ||
| turn | 0.188 | ||
| sheet | 0.238 | ||