| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190692.1 | internal | 173 | 3-521(+) |
Amino Acid sequence : | |||
| TGVADGRILKWNGGEWVEFAVTSSNRDACSKPLNLAMEHVCGRPLGLRFHRKTGDLYIADAYLGLQVVGPTGGVATPLVTEVEGQRLRFTNDLDIDEENDVIYFSDSSTEYYRREFMKSV LTMDKTGKLMKYDISSKVVTVLLRGIAFANGVSLSKDHSFVLVDETTKFRVLR | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 19,316.804 | ||
| Theoretical pI: | 6.278 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 21.245 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.171 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.214 | ||
| sheet | 0.237 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190692.1 | internal | 173 | 3-521(+) |
Amino Acid sequence : | |||
| TGVADGRILKWNGGEWVEFAVTSSNRDACSKPLNLAMEHVCGRPLGLRFHRKTGDLYIADAYLGLQVVGPTGGVATPLVTEVEGQRLRFTNDLDIDEENDVIYFSDSSTEYYRREFMKSV LTMDKTGKLMKYDISSKVVTVLLRGIAFANGVSLSKDHSFVLVDETTKFRVLR | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 19,316.804 | ||
| Theoretical pI: | 6.278 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 21.245 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.171 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.214 | ||
| sheet | 0.237 | ||